Cytoplasm Marker Antibodies

Jump to Filters
View as table Download
GAPDHS Rabbit Polyclonal Antibody
TA366938

USD 380.00

4 Weeks

GAPDHS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAPDHS
TA366938 is a possible alternative to TA350930.
GAPDHS Rabbit Polyclonal Antibody
TA350930

USD 380.00

In Stock

Rabbit Polyclonal Anti-GAPDHS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAPDHS
GAPDHS Rabbit Polyclonal Antibody
TA345676

USD 539.00

5 Days

Rabbit Polyclonal Anti-GAPDHS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAPDHS antibody: synthetic peptide directed towards the N terminal of human GAPDHS. Synthetic peptide located within the following region: PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI
GAPDHS Rabbit Polyclonal Antibody
TA376480

USD 365.00

3 Weeks

GAPDHS Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 179-408 of human GAPDHS (NP_055179.1).
Modifications Unmodified