Centrosome Marker Antibodies

View as table Download

Rabbit polyclonal anti-RAD51L1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD51L1.

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: IPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW