Germany
Japan
United Kingdom
China
Centrosome Marker Antibodies
View as table Download
Rabbit Polyclonal Anti-GNAI1 Antibody
| Applications | WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH |
Rabbit Polyclonal Anti-GNAI2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAI2 antibody: synthetic peptide directed towards the C terminal of human GNAI2. Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA |
Rabbit Polyclonal MEK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1 |
Rabbit Polyclonal MEK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 |
Rabbit Polyclonal MEK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 |
Rabbit Polyclonal MEK1 (Thr291) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1 around the phosphorylation site of Threonine 291 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MEK1/2 (Ser217) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 around the phosphorylation site of Serine 217 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MEK1/2 (Ser221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 around the phosphorylation site of Serine 221 |
| Modifications | Phospho-specific |
Rabbit Anti-MEK1 (Thr386) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr386 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GNAI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAI2 antibody: synthetic peptide directed towards the middle region of human GNAI2. Synthetic peptide located within the following region: EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL |
Rabbit anti Mek1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 580.00
5 Days
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to amino acids 345 - 354 of Gialpha1 and 346-355 of Gialpha2. |
Active filters
Isotypes
- IgG
Clonalities
- Polyclonal
Pathways
- Chemokine signaling pathway