Germany
Japan
United Kingdom
China
Centrosome Marker Antibodies
View as table Download
Rabbit Polyclonal antibody to MP1 (MAPK scaffold protein 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 124 of MP1 (Uniprot ID#Q9UHA4) |
Rabbit Polyclonal MEK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1 |
Rabbit Polyclonal MEK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 |
Rabbit Polyclonal MEK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 |
Rabbit Polyclonal MEK1 (Thr291) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1 around the phosphorylation site of Threonine 291 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MEK1/2 (Ser217) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 around the phosphorylation site of Serine 217 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MEK1/2 (Ser221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 around the phosphorylation site of Serine 221 |
| Modifications | Phospho-specific |
Rabbit Anti-MEK1 (Thr386) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr386 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-LAMTOR3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMTOR3 antibody is: synthetic peptide directed towards the N-terminal region of Human LAMTOR3. Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK |
Rabbit anti Mek1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- WB
Isotypes
- IgG
Pathways
- MAPK signaling pathway