Germany
Japan
United Kingdom
China
Centrosome Marker Antibodies
View as table Download
PLK1 (161-440) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 161 and 440 of Human PLK1 |
Rabbit polyclonal Plk1 phospho T210 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Polo-like Kinase pT210 Antibody was produced by repeated immunizations with a synthetic phospho peptide corresponding to aa 205-214 of Human Polo-like kinase 1 (Plk1) protein. |
Rabbit Polyclonal Anti-CDK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
PLK1 (C-term) Receptor Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This PLK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 573-603 amino acids from the C-terminal region of human PLK1. |
TA300014 is a replacement of TA300014-1.
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Pathways
- Progesterone-mediated oocyte maturation