Germany
Japan
United Kingdom
China
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
| Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
| Conjugation | Unconjugated |
B Cell Lineage
View as table Download
USD 735.00
3 Days
USD 490.00
3 Days
Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Pig, Rat, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
Rabbit Polyclonal antibody to alpha Actin (cardiac muscle) (actin, alpha, cardiac muscle 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Pig, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 99 and 354 of alpha Actin (cardiac muscle) (Uniprot ID#P68032) |
Rabbit Polyclonal antibody to KPNA4 (karyopherin alpha 4 (importin alpha 3))
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Xenopus, Chicken, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 459 and 521 of KPNA4 (Uniprot ID#O00629) |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Rabbit Polyclonal antibody to Collagen III alpha1 (collagen, type III, alpha 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Chicken, Rat, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1247 and 1389 of Collagen III alpha1 |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit polyclonal ACTA1/Alpha-actin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig, Rabbit, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This ACTA1/Alpha-actin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 346-375 amino acids from the C-terminal region of human ACTA1/Alpha-actin. |
Rabbit polyclonal anti-AKT antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | AKT Antibody was produced from whole rabbit serum prepared by repeated immunizations with a synthetic peptide C-R-P-H-F-P-Q-F-S-Y-S-A-S-G-T-A corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Rabbit Polyclonal Anti-HIF1A Antibody
| Applications | WB |
| Reactivities | Human, Chicken, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA |
Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Chicken, Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726) |
Collagen type I rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Chicken |
| Conjugation | Unconjugated |
| Immunogen | Purified collagen type I from chicken skin |
Rabbit polyclonal anti-ACTA1(alpha Actin, skeletal muscle) antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Pig, Chicken, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 377 of alpha Actin (skeletal muscle) |
Active filters
Reactivities
- Chicken
Filter by
Target Symbol
- CD8A (14)
- ACTA2 (6)
- ACTIN (4)
- AKT1 (4)
- KIT (4)
- ERK2 (3)
- TPM1 (3)
- ALPHA TUBULIN (2)
- AMPK ALPHA 1 (2)
- FGFR1 (2)
- HSP90AA1 (2)
- ITGAV (2)
- KCNMA1 (2)
- ACTA1 (1)
- ACTC1 (1)
- ACTN1 (1)
- ALPHA ADAPTIN (1)
- ALPHA B CRYSTALLIN (1)
- ALPHA SMOOTH MUSCLE ACTIN (1)
- AMPK ALPHA 2 (1)
- CD49B (1)
- CKII ALPHA (1)
- COL1A1 (1)
- COLLAGEN III (1)
- CSNK2A1 (1)
- CXCR4 (1)
- DAG1 (1)
- GAMMA ACTIN (1)
- GJA1 (1)
- HIF-1 ALPHA (1)
- HSP90AB1 (1)
- INTEGRIN ALPHA 6 (1)
- KPNA4 (1)
- LIS1 (1)
- LRPAP1 (1)
- MAPK14 (1)
- MC1 RECEPTOR (1)
- MTGR1 (1)
- MYH1E (1)
- NICOTINIC ACETYLCHOLINE RECEPTOR ALPHA 7 (1)
- NON NEURONAL ENOLASE (1)
- P38 (1)
- PSMA7 (1)
- RUNX2 (1)
- SRPRA (1)
- ST3GAL2 (1)
- TUBULIN (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Assay Types
Families
Pathways
- Pathways in cancer (14)
- Prostate cancer (11)
- Focal adhesion (10)
- Hypertrophic cardiomyopathy (HCM) (10)
- Progesterone-mediated oocyte maturation (10)
- mTOR signaling pathway (10)
- Insulin signaling pathway (9)
- MAPK signaling pathway (9)
- Melanoma (8)
- Regulation of actin cytoskeleton (8)
- Adherens junction (7)
- Chemokine signaling pathway (7)
- Dilated cardiomyopathy (7)
- Fc epsilon RI signaling pathway (7)
- NOD-like receptor signaling pathway (7)
- Neurotrophin signaling pathway (7)
- Renal cell carcinoma (7)
- T cell receptor signaling pathway (7)
- Toll-like receptor signaling pathway (7)
- VEGF signaling pathway (7)
- Acute myeloid leukemia (6)
- Adipocytokine signaling pathway (6)
- B cell receptor signaling pathway (6)
- Chronic myeloid leukemia (6)
- Colorectal cancer (6)
- Endometrial cancer (6)
- ErbB signaling pathway (6)
- Fc gamma R-mediated phagocytosis (6)
- Gap junction (6)
- Glioma (6)
- Non-small cell lung cancer (6)
- Pancreatic cancer (6)
- Vascular smooth muscle contraction (6)
- Small cell lung cancer (5)
- Tight junction (5)
- Axon guidance (4)
- Cardiac muscle contraction (4)
- GnRH signaling pathway (4)
- Melanogenesis (4)
- Pathogenic Escherichia coli infection (4)
- Alzheimer's disease (3)
- Antigen processing and presentation (3)
- Apoptosis (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Bladder cancer (3)
- Dorso-ventral axis formation (3)
- ECM-receptor interaction (3)
- Jak-STAT signaling pathway (3)
- Leukocyte transendothelial migration (3)
- Long-term depression (3)
- Long-term potentiation (3)
- Metabolic pathways (3)
- Natural killer cell mediated cytotoxicity (3)
- Oocyte meiosis (3)
- Prion diseases (3)
- Regulation of autophagy (3)
- TGF-beta signaling pathway (3)
- Thyroid cancer (3)
- Type II diabetes mellitus (3)
- Endocytosis (2)
- Hematopoietic cell lineage (2)
- Amyotrophic lateral sclerosis (ALS) (1)
- Calcium signaling pathway (1)
- Cell adhesion molecules (CAMs) (1)
- Cytokine-cytokine receptor interaction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Ether lipid metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Huntington's disease (1)
- Keratan sulfate biosynthesis (1)
- Neuroactive ligand-receptor interaction (1)
- O-Glycan biosynthesis (1)
- Proteasome (1)
- RIG-I-like receptor signaling pathway (1)
- RNA degradation (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- Wnt signaling pathway (1)