POLR2K (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
POLR2K (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, POLR2K (Myc-DDK tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, POLR2K (mGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
POLR2K (tGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-POLR2K Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR2K antibody: synthetic peptide directed towards the middle region of human POLR2K. Synthetic peptide located within the following region: DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR |
POLR2K (1-58, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
POLR2K (1-58, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
POLR2K HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
POLR2K MS Standard C13 and N15-labeled recombinant protein (NP_005025)
Tag | C-Myc/DDK |
Expression Host | HEK293 |