B Cell Lineage

Proteins (9)
cDNA Clones (7)
Antibodies (1)
Jump to Filters
View as table Download
POLR2K (NM_005034) Human Tagged ORF Clone
RC201957

USD 150.00

In Stock

POLR2K (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
POLR2K (NM_005034) Human Tagged ORF Clone Lentiviral Particle
RC201957L3V

USD 700.00

5 Weeks

Lenti ORF particles, POLR2K (Myc-DDK tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR2K (NM_005034) Human Tagged ORF Clone Lentiviral Particle
RC201957L4V

USD 700.00

5 Weeks

Lenti ORF particles, POLR2K (mGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR2K (NM_005034) Human Tagged ORF Clone
RG201957

USD 350.00

In Stock

POLR2K (tGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR2K (NM_005034) Human Tagged Lenti ORF Clone
RC201957L3

USD 450.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR2K (NM_005034) Human Tagged Lenti ORF Clone
RC201957L4

USD 450.00

3 Weeks

Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR2K Rabbit Polyclonal Antibody
TA346735

USD 539.00

5 Days

Rabbit Polyclonal Anti-POLR2K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2K antibody: synthetic peptide directed towards the middle region of human POLR2K. Synthetic peptide located within the following region: DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR
POLR2K (1-58, His-tag) Human Protein
AR51712PU-N

USD 1,245.00

3 Weeks

POLR2K (1-58, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
POLR2K (1-58, His-tag) Human Protein
AR51712PU-S

USD 510.00

3 Weeks

POLR2K (1-58, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
POLR2K (NM_005034) Human Over-expression Lysate
LC417596

USD 134.00

2 Weeks

POLR2K HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR2K (NM_005034) Human Over-expression Lysate
LY417596

USD 436.00

5 Days

Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR2K (NM_005034) Human Mass Spec Standard
PH301957

USD 3,255.00

3 Weeks

POLR2K MS Standard C13 and N15-labeled recombinant protein (NP_005025)

Tag C-Myc/DDK
Expression Host HEK293