CACNA2D1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CACNA2D1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CACNA2D1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, CACNA2D1 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF particles, CACNA2D1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNA2D1 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CACNA2D1 (tGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CACNA2D1 (tGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CACNA2D1 (myc-DDK-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-CACNA2D1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI |
Transient overexpression lysate of calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Asp253-Leu430, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |