B Cell Lineage

View as table Download

CACNA2D1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, CACNA2D1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, CACNA2D1 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, CACNA2D1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CACNA2D1 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CACNA2D1 (tGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNA2D1 (tGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNA2D1 (myc-DDK-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-CACNA2D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI

Transient overexpression lysate of calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Purified recombinant protein of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Asp253-Leu430, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli