Germany
Japan
United Kingdom
China
PIP4K2B (Myc-DDK-tagged)-Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
B Cell Lineage
View as table Download
USD 1,007.00
5 Weeks
Lenti ORF particles, PIP4K2B (Myc-DDK tagged) - Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,007.00
5 Weeks
Lenti ORF particles, PIP4K2B (mGFP-tagged) - Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), 1 mg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), 100 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PIP4K2B (tGFP-tagged) - Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
PIP4K2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-PIP4K2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIP4K2B Antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2B. Synthetic peptide located within the following region: DVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEIS |
Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PIP4K2B MS Standard C13 and N15-labeled recombinant protein (NP_003550)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Lenti ORF clone of Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
PIP4K2B (untagged)-Human phosphatidylinositol-5-phosphate 4-kinase, type II, beta (PIP4K2B)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PIP5K2B (untagged)-Human phosphatidylinositol-4-phosphate 5-kinase, type II, beta (PIP5K2B), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Active filters
Target Symbol
- PIP5K2 BETA
Pathways
- Fc gamma R-mediated phagocytosis