Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 17 amino acid peptide near the amino terminus of human PPARGC1A. The immunogen is located within amino acids 200 - 250 of PPARGC1A. |
Rabbit Polyclonal Anti-Ppargc1a Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppargc1a antibody: synthetic peptide directed towards the middle region of mouse Ppargc1a. Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL |
Rabbit Polyclonal Anti-Ppargc1a Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppargc1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD |
Goat Polyclonal Antibody against PPARGC1A
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DGLFDDSEDESDK, from the internal region of the protein sequence according to NP_037393.1. |
Germany
Japan
United Kingdom
China
