B Cell Lineage

View as table Download

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Pdpn hamster monoclonal antibody, clone 811, Purified

Applications IHC, IP, WB
Reactivities Mouse
Conjugation Unconjugated

Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mouse, Rat, Sheep
Conjugation Unconjugated
Immunogen Collagen type II purified from Human knee and Bovine nasal cartilage.

Rabbit polyclonal Collagen II antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Collagen II.

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

Calca goat polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Mouse, Reptiles, Rat, Guinea Pig
Conjugation Unconjugated
Immunogen Synthetic Rat Tyr-CGRP (23-37) conjugated to gamma Globulin

Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH

Anti-AACT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-303 amino acids of Human Alpha-1-antichymotrypsin

Rabbit Polyclonal CXCR4 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4.

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW

Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K).
Modifications Phospho-specific

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human (Predicted: Mouse, Rat, Drosophila)
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100)

Goat Polyclonal Anti-HIF1a Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli.

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific