Rabbit Polyclonal Antibody against LC3B
| Applications | Electron Microscopy, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of the human LC3, isoform B protein. |
Rabbit Polyclonal Antibody against LC3
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121). |
Rabbit Polyclonal Antibody against ATG5
| Applications | Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal Antibody against LC3
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal portion of the human LC3 protein sequence (between residues 1-100). |
Rabbit Polyclonal Antibody against Beclin 1
| Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | NB 500-249 was raised against an internal synthetic peptide to human Beclin 1, containing residues within 1-100. This sequence has 94% identity with the mouse sequence and 88% identity with the rat sequence. |
Rabbit polyclonal LC3 Antibody (APG8B) (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This LC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human LC3. |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Genomic sequence made to an N-terminal portion of the human LC3A protein [Swiss-Prot# Q9H492]. |
Rabbit polyclonal ATG5 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ATG5. |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal Anti-ATG5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
Rabbit Polyclonal ATG9A Antibody
| Applications | FC, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the C-terminus of human ATG9A (between residues 750-839). [Swiss-Prot# Q7Z3C6]. |
Rabbit polyclonal Cleaved LC3A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This Cleaved LC3A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-120 amino acids from human Cleaved LC3A. |
Germany
Japan
United Kingdom
China
