Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
Rabbit Polyclonal EAAT1/GLAST-1/SLC1A3 Antibody
| Applications | ELISA, FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat SLC1A3 protein (between residues 500-542) [UniProt P24942] |
GFAP (K39) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | GFAP preparation from Human spinal cord. |
Rabbit Polyclonal Anti-SLC1A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the N terminal of human SLC1A2. Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK |
Anti-SLC1A2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 556-574 amino acids of human solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
GFAP Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human GFAP (NP_002046.1). |
| Modifications | Unmodified |
S100B Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100B (NP_006263.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
