purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700496 |
purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700496 |
USD 494.00
In Stock
CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600035, TA600034 |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
BRAF mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700012 |
AKT1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700055, TA700077 |
APC2 rabbit polyclonal antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | APC2 antibody was raised against synthetic peptide - KLH conjugated |
Mouse monoclonal Akt phospho T308 antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
USD 458.00
In Stock
CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays
Applications | LMNX |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700034, TA700141 |
purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700497 |
USD 494.00
In Stock
BRAF biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600012 |
USD 494.00
In Stock
AKT1 biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600055 |
USD 494.00
In Stock
MAPK1 biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600063 |
KRAS mouse monoclonal antibody, clone AT2F8, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |