USD 509.00
2 Weeks
Anti-BRAF mouse monoclonal antibody, clone OTI4A5 (formerly 4A5), Biotinylated
Applications | ELISA, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
Anti-BRAF mouse monoclonal antibody, clone OTI4A5 (formerly 4A5), Biotinylated
Applications | ELISA, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
Anti-BRAF mouse monoclonal antibody, clone OTI4A5 (formerly 4A5), HRP conjugated
Applications | ELISA, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-Human PlGF-1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human PlGF-1 |
Anti-BRAF mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 3H2, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
AKT1 (C-term) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
MAPK1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700062, TA700064 |
ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Akt phospho S473 antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal E2F1 Antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
BRAF mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700012 |
AKT1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700055, TA700077 |
Mouse monoclonal Akt phospho T308 antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |