Assay Kits

View as table Download

Anti-BRAF mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications ELISA, IHC, IP, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

AKT1 (C-term) rabbit polyclonal antibody, Serum

Applications ELISA, IF, IHC, IP, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide.

MAPK1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700062, TA700064

SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

Mouse monoclonal Akt phospho S473 antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700496

STAT5A biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600173

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal AML1-ETO Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AML1-ETO antibody: the AML1-ETO fusion protein using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal NRAS Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal E2F1 Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.