Assay Kits

Jump to Filters
View as table Download
beta Catenin (CTNNB1) Mouse Monoclonal Capture Antibody [Clone ID: OTI2H3]
TA600035

USD 458.00

In Stock

CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays

Applications ELISA, LMNX
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700034, TA700035
beta Catenin (CTNNB1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI6E7]
TA700035

USD 494.00

In Stock

CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600035, TA600047, TA600141
beta Catenin (CTNNB1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI12C1]
TA700034

USD 494.00

In Stock

CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600035, TA600034
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
E2F1 Rabbit Polyclonal Antibody
TA590609

USD 482.00

In Stock

Rabbit Polyclonal E2F1 Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
beta Catenin (CTNNB1) Mouse Monoclonal Capture Antibody [Clone ID: OTI9F6]
TA600034

USD 458.00

In Stock

CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays

Applications LMNX
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700034, TA700141
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
beta Catenin (CTNNB1) Mouse Monoclonal Capture Antibody [Clone ID: OTI1B11]
TA600141

USD 458.00

In Stock

CTNNB1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700035
beta Catenin (CTNNB1) Mouse Monoclonal Capture Antibody [Clone ID: OTI1B11]
TA600047

USD 458.00

2 Weeks

CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700035, TA700047
beta Catenin (CTNNB1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI12H7]
TA700141

USD 494.00

2 Weeks

CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600034
MDM2 Rabbit Polyclonal Antibody
TA590123

USD 482.00

In Stock

Rabbit Polyclonal MDM2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
MDM2 Rabbit Polyclonal Antibody
TA590125

USD 482.00

In Stock

Rabbit Polyclonal MDM2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
MDM2 Rabbit Polyclonal Antibody
TA590126

USD 482.00

In Stock

Rabbit Polyclonal MDM2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
p53 (TP53) (Wild type + Mutant) (20-31) Mouse Monoclonal Antibody [Clone ID: Bp53-11]
AM09102PU-N

USD 425.00

2 Weeks

p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
EP300 Rabbit Polyclonal Antibody
R1015

USD 780.00

3 Days

EP300 rabbit polyclonal antibody, Supernatant

Applications ELISA, EMSA, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen P300 peptide corresponding to a region near the N-terminus of the Human protein conjugated to KLH.