Assay Kits

View as table Download

TNF-A mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700026

TNF-A biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600026

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I

TNFRSF1A biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600021

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

TNFRSF1A mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700021

Biotinylated Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Biotin
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified

Applications ELISA, FN, WB
Reactivities Human
Conjugation Unconjugated

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified

Applications ELISA, FN
Reactivities Human
Conjugation Unconjugated

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin

Applications ELISA
Reactivities Human
Conjugation Biotin

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP

Applications ELISA
Reactivities Human
Conjugation HRP