Assay Kits

View as table Download

Anti-BRAF mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)

Applications ELISA, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EGF mouse monoclonal antibody, clone S-21, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Anti-BRAF mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications ELISA, IHC, IP, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BRAF mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications ELISA, IHC, IP, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Anti-BRAF mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)

Applications ELISA, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BRAF mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)

Applications ELISA, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BRAF mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)

Applications ELISA, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IL-8 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700024

Anti-Human PlGF-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PlGF-1

Anti-BRAF mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications ELISA, IHC, IP, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MAPK1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700062, TA700064

ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700496

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE