Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
Assay Kits
View as table Download
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Active filters
Filter by
Target Symbol
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Assay Types
Families
- Druggable Genome (61)
- Protein Kinase (41)
- ES Cell Differentiation/IPS (21)
- Stem cell relevant signaling - JAK/STAT signaling pathway (14)
- Transmembrane (13)
- Stem cell - Pluripotency (10)
- Transcription Factors (10)
- Adult stem cells (9)
- Cancer stem cells (9)
- Secreted Protein (9)
- Embryonic stem cells (5)
- Induced pluripotent stem cells (5)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (5)
- Stem cell relevant signaling - Wnt Signaling pathway (5)
- GPCR (1)
- Protease (1)