Assay Kits

View as table Download

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Mouse monoclonal Akt phospho T308 antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated

KRAS mouse monoclonal antibody, clone AT2F8, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

EGF mouse monoclonal antibody, clone S-146, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

KRAS mouse monoclonal antibody, clone AT2F8, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-BRAF mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)

Applications ELISA, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

EGF rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human EGF (hEGF).

ERK1 (MAPK3) mouse monoclonal antibody, clone AT1A2, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

ERK1 (MAPK3) mouse monoclonal antibody, clone AT1A2, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

EGFR mouse monoclonal antibody, clone AT2H8, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

EGFR mouse monoclonal antibody, clone AT2H8, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated