Rabbit Polyclonal PCNA Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal PCNA Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal HDAC2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
PLK1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700111, TA700137, TA700138, TA700139 |
Rabbit Polyclonal BubR1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Mouse Monoclonal DNA-PKcs Antibody (3H6)
Applications | ELISA, ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal p18 INK4c Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
CDK6 mouse monoclonal antibody, clone 8H4, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 430.00
3 Weeks
14-3-3 theta (YWHAQ) (1-245) mouse monoclonal antibody, clone AT1A1, Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 315.00
3 Weeks
14-3-3 theta (YWHAQ) (1-245) mouse monoclonal antibody, clone AT1A1, Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700496 |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal E2F1 Antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Cyclin A2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700497 |
purified BUB1B mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700521, TA700531 |