Antibodies

Jump to Filters
View as table Download
p66 alpha (GATAD2A) Rabbit Polyclonal Antibody
TA345224

USD 539.00

5 Days

Rabbit Polyclonal Anti-GATAD2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATAD2A antibody: synthetic peptide directed towards the N terminal of human GATAD2A. Synthetic peptide located within the following region: RMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTGSVGSTVTTPPP
p66 alpha (GATAD2A) Rabbit Polyclonal Antibody
TA361697

USD 539.00

5 Days

GATAD2A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GATAD2A