Antibodies

View as table Download

CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CRYM mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Biotin

CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation HRP

Anti-CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CRYM mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1B5 (formerly 1B5), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-CRYM (mu Crystallin) mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CRYM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRYM antibody: synthetic peptide directed towards the N terminal of human CRYM. Synthetic peptide located within the following region: ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRT

Rabbit Polyclonal Anti-CRYM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRYM antibody: synthetic peptide directed towards the middle region of human CRYM. Synthetic peptide located within the following region: AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA