Rabbit polyclonal anti-Tubulin ? antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human tubulin ?. |
Rabbit polyclonal anti-Tubulin ? antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human tubulin ?. |
Mouse Monoclonal anti-Tubulin-? Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
gamma Tubulin (TUBG1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 380-430 of Human Tubulin γ. |
Rabbit Polyclonal Tubulin gamma Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Tubulin gamma |
Rabbit Polyclonal anti-Tubulin-? Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide-KLH |
Rabbit Polyclonal Tubulin gamma Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Tubulin gamma. |
Rabbit Polyclonal Anti-TUBG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TUBG2 Antibody: synthetic peptide directed towards the middle region of human TUBG2. Synthetic peptide located within the following region: FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI |
Rabbit anti Tubulin gamma Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to aa 432-451 of human tubulin. |
TUBG1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TUBG1 |
gamma Tubulin (TUBG1) mouse monoclonal antibody, clone IMD-20, Purified
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |