Antibodies

Jump to Filters
View as table Download
eIF3s8 (EIF3C) (N-term) Rabbit Polyclonal Antibody
AP51396PU-N

USD 580.00

2 Weeks

eIF3s8 (EIF3C) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 127-155 amino acids from the N-terminal region of Human EIF3CL.
eIF3s8 (EIF3C) Rabbit Polyclonal Antibody
TA338211

USD 539.00

5 Days

Rabbit Polyclonal Anti-EIF3C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF3C antibody is: synthetic peptide directed towards the N-terminal region of Human EIF3C. Synthetic peptide located within the following region: NEMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEED
eIF3s8 (EIF3C) (Center) Rabbit Polyclonal Antibody
AP51395PU-N

USD 580.00

2 Weeks

eIF3s8 (EIF3C) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 537-567 amino acids from the Central region of human EIF3C
eIF3s8 (EIF3C) Rabbit Polyclonal Antibody
TA363739

USD 539.00

5 Days

EIF3C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EIF3C