Rabbit Polyclonal Anti-Zfp27 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Zfp27 Antibody is: synthetic peptide directed towards the middle region of Mouse Zfp27. Synthetic peptide located within the following region: KPYGCTDCGKSFTSKSQLLVHRPIHTGEKPYVCAECGKAFSGRSNLSKHQ |
Rabbit Polyclonal Anti-Zfp27 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Zfp27 antibody is: synthetic peptide directed towards the middle region of Mouse Zfp27. Synthetic peptide located within the following region: HRRIHTGEKLYDCSHCGKGFSYNSDLRIHQKIHTGEKRHGCVDCGKAFTQ |
Germany
Japan
United Kingdom
China