Antibodies

Jump to Filters
View as table Download
Pokemon (ZBTB7A) Rabbit Polyclonal Antibody
TA319921

USD 570.00

5 Days

Rabbit Polyclonal ZBTB7A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ZBTB7A antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human ZBTB7A.
Zbtb7a Rabbit Polyclonal Antibody
TA342277

USD 485.00

5 Days

Rabbit Polyclonal Anti-ZBTB7A Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB7A antibody: synthetic peptide directed towards the N terminal of mouse ZBTB7A. Synthetic peptide located within the following region: LEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF
Zbtb7a Rabbit Polyclonal Antibody
TA356026

USD 539.00

5 Days

Zbtb7a Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated