ZBTB44 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ZBTB44 |
ZBTB44 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ZBTB44 |
Rabbit Polyclonal Anti-Zbtb44 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Zbtb44 antibody is: synthetic peptide directed towards the N-terminal region of Rat Zbtb44. Synthetic peptide located within the following region: VKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDRIFRAHKVVLAAC |