Antibodies

Jump to Filters
View as table Download
ZSCAN2 (N-term) Rabbit Polyclonal Antibody
AP54740PU-N

USD 580.00

2 Weeks

ZSCAN2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 116-147 amino acids from the N-terminal region of human ZSCAN2
ZSCAN2 Rabbit Polyclonal Antibody
TA332280

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZSCAN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZSCAN2 Antibody: synthetic peptide directed towards the N terminal of human ZSCAN2. Synthetic peptide located within the following region: MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDG
ZSCAN2 Rabbit Polyclonal Antibody
TA345620

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZSCAN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZSCAN2 antibody: synthetic peptide directed towards the N terminal of human ZSCAN2. Synthetic peptide located within the following region: TTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRL
ZSCAN2 Rabbit Polyclonal Antibody
TA345621

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZSCAN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZSCAN2 antibody: synthetic peptide directed towards the middle region of human ZSCAN2. Synthetic peptide located within the following region: GKGFSWNSVLIIHQRIHTGEKPYKCPECGKGFSNSSNFITHQRTHMKEKL
ZSCAN2 Rabbit Polyclonal Antibody
TA383625

USD 365.00

3 Weeks

ZSCAN2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ZSCAN2 (NP_870992.2).