Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ZNF435 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF435. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZNF435 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF435 antibody: synthetic peptide directed towards the middle region of human ZNF435. Synthetic peptide located within the following region: TKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQ |
Rabbit Polyclonal Anti-ZSCAN16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZSCAN16 antibody: synthetic peptide directed towards the N terminal of human ZSCAN16. Synthetic peptide located within the following region: MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQ |
Rabbit Polyclonal Anti-ZSCAN16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZSCAN16 antibody: synthetic peptide directed towards the C terminal of human ZSCAN16. Synthetic peptide located within the following region: KDFSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY |
Active filters
Target Symbol
- ZSCAN16