Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZNF707 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF707 antibody: synthetic peptide directed towards the N terminal of human ZNF707. Synthetic peptide located within the following region: EPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVEDRERPE |
Rabbit Polyclonal Anti-ZNF707 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF707 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF707. Synthetic peptide located within the following region: ECGKSFRWPKGFSIHRRLHLTKRFYECGHCGKGFRHLGFFTRHQRTHRHG |
Active filters
Target Symbol
- ZNF707