Antibodies

View as table Download

Rabbit Polyclonal Anti-ZNF70 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the N terminal of human ZNF70. Synthetic peptide located within the following region: ETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPY

Rabbit Polyclonal Anti-ZNF70 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the C terminal of human ZNF70. Synthetic peptide located within the following region: GKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

Rabbit Polyclonal Anti-ZNF70 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the N terminal of human ZNF70. Synthetic peptide located within the following region: MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKE

ZNF70 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ZNF70 (NP_068735.1).
Modifications Unmodified