Antibodies

Jump to Filters
View as table Download
ZNF665 (N-term) Rabbit Polyclonal Antibody
AP54707PU-N

USD 580.00

2 Weeks

ZNF665 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 77-107 amino acids from the N-terminal region of human ZNF665
ZNF665 Rabbit Polyclonal Antibody
TA341396

USD 485.00

5 Days

Rabbit Polyclonal Anti-ZNF665 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF665 antibody: synthetic peptide directed towards the N terminal of human ZNF665. Synthetic peptide located within the following region: LGVSFQSHLPELQQFQREGKIYEYNQVEKSPNNRGKHYKCDECGKVFSQN
ZNF665 Rabbit Polyclonal Antibody
TA341397

USD 485.00

5 Days

Rabbit Polyclonal Anti-ZNF665 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF665 antibody: synthetic peptide directed towards the N terminal of human ZNF665. Synthetic peptide located within the following region: CGKAFTVRSNLTIHQVIHTGEKPYKCNECGKVFSQPSNLAGHQRIHTGEK