Rabbit Polyclonal Anti-ZNF563 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF563 antibody: synthetic peptide directed towards the N terminal of human ZNF563. Synthetic peptide located within the following region: ETIRNLDCIRMIWEEQNTEDQYKNPRRNLRCHMVERFSESKDSSQCGETF |
Rabbit Polyclonal Anti-ZNF563 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF563 antibody is: synthetic peptide directed towards the middle region of Human ZNF563. Synthetic peptide located within the following region: SYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKFP |
ZNF563 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ZNF563 (NP_660319.1). |
Germany
Japan
United Kingdom
China