Rabbit Polyclonal Anti-ZNF444 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF444 antibody: synthetic peptide directed towards the C terminal of human ZNF444. Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH |
ZNF444 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ZNF444. |
Rabbit Polyclonal Anti-ZNF444 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF444 antibody: synthetic peptide directed towards the middle region of human ZNF444. Synthetic peptide located within the following region: SSATRVPQDVTQGPGATGGKEDSGMIPLAGTAPGAEGPAPGDSQAVRPYK |
Germany
Japan
United Kingdom
China
