Rabbit Polyclonal Anti-ZNF408 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF408 Antibody: synthetic peptide directed towards the middle region of human ZNF408. Synthetic peptide located within the following region: FKAHMLGHRGVRPFPCPQCDKAYGTQRDLKEHQVVHSGARPFACDQCGKA |
Rabbit Polyclonal Anti-ZNF408 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF408 Antibody: synthetic peptide directed towards the middle region of human ZNF408. Synthetic peptide located within the following region: ERPFPCPQCGRAYTLATKLRRHLKSHLEDKPYRCPTCGMGYTLPQSLRRH |
Rabbit Polyclonal Anti-ZNF408 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF408 antibody: synthetic peptide directed towards the N terminal of human ZNF408. Synthetic peptide located within the following region: MEEAEELLLEGKKALQLAREPRLGLDLGWNPSGEGCTQGLKDVPPEPTRD |
Rabbit Polyclonal Anti-ZNF408 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF408 antibody: synthetic peptide directed towards the middle region of human ZNF408. Synthetic peptide located within the following region: TVVLLQAEPQLLDTHREEEVSPARDVVEVTISESQEKCFVVPEEPDAAPS |
ZNF408 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 471-720 of human ZNF408 (NP_079017.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China