Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to ZNF259 (zinc finger protein 259)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rabbit, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 159 and 459 of ZNF259 (Uniprot ID#O75312) |
Rabbit Polyclonal Anti-ZNF259 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF259 antibody: synthetic peptide directed towards the N terminal of human ZNF259. Synthetic peptide located within the following region: PPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMT |
Rabbit Polyclonal Anti-ZNF259 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF259 antibody: synthetic peptide directed towards the C terminal of human ZNF259. Synthetic peptide located within the following region: GNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR |
ZPR1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF259 |
ZPR1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF259 |
ZPR1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF259 |
Active filters
Target Symbol
- ZNF259