Rabbit Polyclonal Anti-ZNF16 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF16 antibody: synthetic peptide directed towards the N terminal of human ZNF16. Synthetic peptide located within the following region: MPSLRTRREEAEMELSVPGPSPWTPAAQARVRDAPAVTHPGSAACGTPCC |
Rabbit Polyclonal Anti-ZNF16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF16 antibody: synthetic peptide directed towards the N terminal of human ZNF16. Synthetic peptide located within the following region: PYDMGGQSFQHSVDLTGHEGVPTAESPLICNECGKTFQGNPDLIQRQIVH |
Rabbit Polyclonal Anti-ZNF16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF16 antibody: synthetic peptide directed towards the C terminal of human ZNF16. Synthetic peptide located within the following region: GKAFSQRSVLIQHQRIHTGVKPYDCAACGKAFSQRSKLIKHQLIHTRE |
ZNF16 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human ZNF16 (NP_008889.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
