Rabbit Polyclonal Anti-WDR26 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wdr26 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Wdr26. Synthetic peptide located within the following region: TERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRSKLLDKLQTYLPPSVML |
WDR26 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR26 |
WDR26 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 362-661 of human WDR26 (NP_079436.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China