Antibodies

View as table Download

Rabbit Polyclonal Anti-WASF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WASF2

Rabbit polyclonal anti-WASF2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human WASF2.

Rabbit Polyclonal Anti-Wasf2

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wasf2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRK

Wasf2 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated