Antibodies

View as table Download

Rabbit Polyclonal Anti-RHOU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RHOU

Rabbit Polyclonal Anti-RHOU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOU antibody: synthetic peptide directed towards the C terminal of human RHOU. Synthetic peptide located within the following region: LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Rabbit Polyclonal Anti-RHOU Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RHOU