Germany
Japan
United Kingdom
China
Antibodies
View as table Download
VSIG1 mouse monoclonal antibody, clone CT1, FITC
| Applications | FC |
| Reactivities | Chicken |
| Conjugation | FITC |
Rabbit Polyclonal Anti-VSIG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VSIG1 Antibody: synthetic peptide directed towards the N terminal of human VSIG1. Synthetic peptide located within the following region: SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN |
VSIG1 mouse monoclonal antibody, clone CT1, Purified
| Applications | FC, FN, IP |
| Reactivities | Chicken |
| Conjugation | Unconjugated |
VSIG1 mouse monoclonal antibody, clone CT1, Biotin
| Applications | FC |
| Reactivities | Chicken |
| Conjugation | Biotin |
VSIG1 mouse monoclonal antibody, clone CT1, PE
| Applications | FC |
| Reactivities | Chicken |
| Conjugation | PE |
Active filters
Target Symbol
- VSIG1