Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-VSX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the middle region of human VSX1. Synthetic peptide located within the following region: LAGLWGSDHFKEGSSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETK |
VSX1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 124-154 amino acids from the Central region of human VSX1 |
Rabbit Polyclonal Anti-Vsx1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vsx1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Vsx1. Synthetic peptide located within the following region: TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV |
Rabbit Polyclonal Anti-Vsx1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vsx1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RSRSRALAPGCPPTGSRLRSFAINDLLGLEADLPTPAEPGLRSNSGDPAE |
Rabbit Polyclonal Anti-VSX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the middle region of human VSX1. Synthetic peptide located within the following region: FLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASP |
Rabbit Polyclonal Anti-VSX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the N terminal of human VSX1. Synthetic peptide located within the following region: MTGRDSLSDGRTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPAPAGPG |
Rabbit Polyclonal Anti-VSX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the middle region of human VSX1. Synthetic peptide located within the following region: VSPENGLEDVAIDLSSSARQETKKVHPGAGAQGGSNSTALEGPQPGKVGA |
Active filters
Target Symbol
- VSX1