Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against VPS28
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ESAYNAFNRFLHA, from the C Terminus of the protein sequence according to NP_057292.1. |
Rabbit Polyclonal Anti-VPS28 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VPS28 antibody: synthetic peptide directed towards the N terminal of human VPS28. Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ |
VPS28 Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human VPS28 (NP_057292.1). |
| Modifications | Unmodified |
VPS28 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse VPS28 |
Active filters
Target Symbol
- VPS28