Antibodies

View as table Download

Rabbit polyclonal anti-UTP14A antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human UTP14A.

Rabbit Polyclonal Anti-UTP14A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UTP14A antibody: synthetic peptide directed towards the N terminal of human UTP14A. Synthetic peptide located within the following region: KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL