Rabbit Polyclonal Anti-C4orf20 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C4orf20 antibody: synthetic peptide directed towards the middle region of human C4orf20. Synthetic peptide located within the following region: TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC |
Rabbit Polyclonal Anti-C4orf20 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C4orf20 antibody: synthetic peptide directed towards the middle region of human C4orf20. Synthetic peptide located within the following region: YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD |
Germany
Japan
United Kingdom
China