Antibodies

View as table Download

UBLCP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UBLCP1

UBLCP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UBLCP1

Rabbit Polyclonal Anti-UBLCP1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBLCP1 antibody: synthetic peptide directed towards the N terminal of human UBLCP1. Synthetic peptide located within the following region: MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV

Rabbit Polyclonal Anti-UBLCP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBLCP1 antibody: synthetic peptide directed towards the N terminal of human UBLCP1. Synthetic peptide located within the following region: MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV