UBLCP1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBLCP1 |
UBLCP1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBLCP1 |
UBLCP1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBLCP1 |
Rabbit Polyclonal Anti-UBLCP1 Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBLCP1 antibody: synthetic peptide directed towards the N terminal of human UBLCP1. Synthetic peptide located within the following region: MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV |
Rabbit Polyclonal Anti-UBLCP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBLCP1 antibody: synthetic peptide directed towards the N terminal of human UBLCP1. Synthetic peptide located within the following region: MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV |