Antibodies

Jump to Filters
View as table Download
Txlng Rabbit Polyclonal Antibody
TA329630

USD 539.00

5 Days

Rabbit polyclonal anti-Txlng antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Txlng antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KADMVCNSQANDILQHQDPSCGGTTKKHSLEGDEGSDFITKNRNLVSSVF
Gamma taxilin (TXLNG) Rabbit Polyclonal Antibody
TA382953

USD 365.00

3 Weeks

TXLNG Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TXLNG (NP_060830.2).
Modifications Unmodified