Antibodies

Jump to Filters
View as table Download
TTC5 Rabbit Polyclonal Antibody
TA306112

USD 570.00

5 Days

Rabbit Polyclonal TTC5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TTC5 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TTC5.
TTC5 Rabbit Polyclonal Antibody
TA329576

USD 539.00

5 Days

Rabbit polyclonal anti-TTC5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TTC5 antibody: synthetic peptide directed towards the C terminal of human TTC5. Synthetic peptide located within the following region: GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV
TTC5 Rabbit Polyclonal Antibody
TA382921

USD 365.00

3 Weeks

TTC5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human TTC5 (NP_612385.2).
Modifications Unmodified